+ Main Category
Biology: 18066
Agriculture: 7689
Horticulture: 3987
Forestry: 843
Geography: 5126
Environment: 5564
Research: 2417
Society: 448
+ Tell a Friend
Fill out the information below to email a friend a brief note about 'TropHort: Biology, Agriculture and Geography'
+ Top 10
+ Directory Statistics
Links: 41726
Categories: 7194
Registered Users: 680
Mailing List Subscribers: 137
+ Pagerank Statistics
+ Join Mailing List
Joining mailing list will entitle you
to receive occasional emails informing you of news and
updates to the site and any special offers that may be
of interest to you.
Carrots.
35204
Carrots.
http://pestdata.ncsu.edu/CropProfiles/docs/OHcarrots.html
Location of Production: Counties with the most acres in carrots are located in the Northwest region of the state. The following counties are the top carrot producers in the state: Henry (614), Fulton (108), and Hardin (40).
Horticulture > Vegetables > Carrot > Science
cercospora leaf spot carrot rust fly leafhoppers aphids larval feeding insect pests baythroid broadleaf
Jan 1, 2003
Write a Review
Add to My Favorite
Refer it to Friend
Report Broken Link
Other links at Horticulture > Vegetables > Carrot > Science
Our Personal Stories Read about our history, our personal struggles as a family running an herb business and stories about Martha Volchok, Co-Founder, herbalist, and mother of four homeschooled children.
Category:
2. Carrot.pdf.
Use or prepare soil that is deep and friable to avoid misshapen roots. Do not plant in areas where young plants may be subject to long periods of cold temperatures, which favors bolting.
Category:
Dark-grown carrot (Daucus carota L.) tissue cultures were found to contain both protein components of the NADP/thioredoxin system--NADP-thioredoxin reductase and the thioredoxin characteristic of heterotrophic systems, thioredoxin h.
Category:
...............................................................................................................
Category:
5. Carrot.
[R] Daucus carota L. (Apiaceae). Fr: Carotte; Ge: Karotte; Sp: Zanahoria; It: Carota; Pt: Cenoura. . - Herbaceous biennial plant with small pink or white umbelliferous flowers, found growing wild in dry plains or at the edge of fields.
Category:
>P83218|PME_DAUCA Pectinesterase - Daucus carota (Carrot). QSSTVTPNVVVAADGSGDYKTVSEAVAAAPEDSKTRYVIRIKAGVYRENVDVPKKKKNIM FLGDGRTSTIITASKNVQDGSTTFNSATVAAVGAGFLARDITFQNTAGAAKHQAVALRVG SDLSAFYRCDILAYQDSLYVHSNRQFFINCFIAGTVDFIFGNAAVVLQDCDIHARRPGSG
Category:
Alabran, D.M. & Mabrouk, A.F. 1973. Carrot flavour, sugars and free nitrogenous compounds in fresh carrots. Journal of Agricultural and Food Chemistry 21: 205-208. Apeland, J. 1974. Storage quality of carrots after different methods of harvesting. Acta Horticulturae 38: 353-357.
Category:
wa.gov.au Cost $44 (including GST). Contents Session 1 AN OVERVIEW OF CURRENT AND FUTURE TRENS IN THE UK AND EUROPEAN CARROT INDUSTRIES P.T. Wright&&&&&&&&&&&&&&&&&&&&&&&&&&&&&...&&&.5 CARROT TRENDS IN NORTH AMERICA R.
Category:
9. Carrot.
Carrot Daucus carota Seed Weight 23,000 seeds/ounce Optimum Soil Temperature for Germination : 45-85 F Seed Longevity : 3 years
Category:
A couple of years ago, I was introduced to wild parsnip (Pastinaca sativa). It was growing in the ditch, and I was reaching for it when four family members screamed, Don t touch! Get back.
Category:
