+ Main Category
Biology: 18066
Agriculture: 7689
Horticulture: 3987
Forestry: 843
Geography: 5126
Environment: 5564
Research: 2212
Society: 448
+ Tell a Friend
Fill out the information below to email a friend a brief note about 'TropHort: Biology, Agriculture and Geography'
+ Top 10
+ Directory Statistics
Links: 41715
Categories: 7194
Registered Users: 638
Mailing List Subscribers: 127
+ Pagerank Statistics
+ Join Mailing List
Joining mailing list will entitle you
to receive occasional emails informing you of news and
updates to the site and any special offers that may be
of interest to you.
research report to the project 'Investigations on the dynamic of growth of selected carrot varieties from biodynamic and ...
35250
research report to the project 'Investigations on the dynamic of growth of selected carrot varieties from biodynamic and ...
http://forschung.uni-kassel.de/cgi-bin/db2www/fobe_en.d2w/en?PNR=1910
Here you can find an short abstract of the research projet 'Investigations on the dynamic of growth of selected carrot varieties from biodynamic and conventional breeding lines, on the optimization of the carrot cultivation and the quality of carrot seeds.' of Unit 'Organic Farming and Cropping' at
Horticulture > Vegetables > Carrot > Science
breeding lines vegetable growing seed quality daucus carota organic farming agricultural sciences central research
Jan 1, 2007
Write a Review
Add to My Favorite
Refer it to Friend
Report Broken Link
Other links at Horticulture > Vegetables > Carrot > Science
a Kentucky State Univ., 218 Atwood Research Facility, Dep. of Plant and Soil Science, Frankfort, KY 40601 b USDA/ARS, Coastal Plains Soil, Water and Plant Research Center, 2611 W. Lucas St., Florence, SC 29501-1242
Category:
PUBLISHED PAPERS RELATING TO CARROT (Daucus carota L.) (in date order) Davey, J.C., Horgan, G.W. & Talbot, M. 1997 Image analysis: a tool for assessing plant uniformity and variety matching. In: Proceedings of the fifth meeting of the EUCARPIA Carrot Working Group. Krakow.
Category:
>P83218|PME_DAUCA Pectinesterase - Daucus carota (Carrot). QSSTVTPNVVVAADGSGDYKTVSEAVAAAPEDSKTRYVIRIKAGVYRENVDVPKKKKNIM FLGDGRTSTIITASKNVQDGSTTFNSATVAAVGAGFLARDITFQNTAGAAKHQAVALRVG SDLSAFYRCDILAYQDSLYVHSNRQFFINCFIAGTVDFIFGNAAVVLQDCDIHARRPGSG
Category:
Currently, three species, the northern root-knot nematode (Meloidogyne hapla), carrot cyst nematode (Heterodera carotae) and P. penetrans root-lesion nematode (Pratylenchus penetrans) are recognized as important pathogens in Michigan (MI) carrot production.
Category:
Leaf Blight (fungus - Alternaria dauci) Infection occurs mostly on older leaves, but younger leaves may also become infected. Leaf blight first appears as indefinite brown to black areas with pale yellow centers. Infected leaves shrivel when infection is heavy [Photo #1].
Category:
Weed management in domestic carrot production is characterized by high yield loss potential, few herbicides, and heavy reliance on handweeding. The most troublesome weed in carrot is volunteer potato and no herbicides are registered for control of the wee...
Category:
Dark-grown carrot (Daucus carota L.) tissue cultures were found to contain both protein components of the NADP/thioredoxin system--NADP-thioredoxin reductase and the thioredoxin characteristic of heterotrophic systems, thioredoxin h.
Category:
Wild carrot: Encyclopedia with 57,959 entries from biotech, medicine & life sciences.
Category:
...............................................................................................................
Category:
Plant and Soil 253: 381390, 2003. © 2003 Kluwer Academic Publishers. Printed in the Netherlands. 381 Bacterial endophytes in processing carrots (Daucus carota L. var. sativus): their localization, population density, biodiversity and their effects on plant growth Monique A. Surette1, Antony V.
Category:
