+ Main Category
Biology: 18066
Agriculture: 7684
Horticulture: 3982
Forestry: 843
Geography: 5126
Environment: 5562
Research: 2212
Society: 445
+ Tell a Friend
Fill out the information below to email a friend a brief note about 'TropHort: Biology, Agriculture and Geography'
+ Top 10
+ Directory Statistics
Links: 41702
Categories: 7193
Registered Users: 592
Mailing List Subscribers: 111
+ Pagerank Statistics
+ Join Mailing List
Joining mailing list will entitle you
to receive occasional emails informing you of news and
updates to the site and any special offers that may be
of interest to you.
>gnl|CDD|2677 pfam02160, Peptidase_A3, Cauliflower mosaic virus...
35470
>gnl|CDD|2677 pfam02160, Peptidase_A3, Cauliflower mosaic virus...
http://bioinfo.hku.hk/db/cdd/pfam02160.csq
>gnl|CDD|2677 pfam02160, Peptidase_A3, Cauliflower mosaic virus peptidase (A3) NPNSIYIKGKLYFKGYKAYSLHCYVDTGASLCIASKKIIPEEYWENAKKPIEVKIANGSIITITKVCSNLFLKIAGKRFL IPTVYQQESGIDLILGNNFCKLYNPFIQYLDRIEFHKKNLEPVEIKKITKAILVGNEGFLESMKKISKTQQPYPFNITIN TIQLEEICSINPGDEEKLFNTIIIKIQLIEPLLEKVCSENP
Horticulture > Vegetables > Cauliflower > Science
cauliflower mosaic peptidase virus
Jan 1, 2004
Write a Review
Add to My Favorite
Refer it to Friend
Report Broken Link
Other links at Horticulture > Vegetables > Cauliflower > Science
Quite possibly, according to Agricultural Research Service (ARS) scientist Li Li. She's using cauliflower to identify genes and define molecular mechanisms that regulate nutrients in plant-based foods. Li, a molecular biologist at the ARS U.S.
Category:
Cauliflower Sources Wks-Transplant to Harv Head Characteristics Comments Outstanding: Concert Osbo, WC 9.5 7-8", tight, dense Wrapper leaves & foliage provide excellent protection Ravella Osbo, Terr 9.5 7-8", tight, dense Foliage provides adequate head protection Titan Osbo 9.
Category:
Indian J Gastroenterol, The official publication of the Indian Society of Gastroenterology (ISG)
Category:
From 1971-1993, Statistics New Zealand's collection covers all farms irrespective of size or location, used or potentially usable for commercial horticulture, vegetable growing, cropping, livestock or forestry operations.
Category:
User: MILLSAPS Food: Cauliflower Ranchero Serving Size: 1/2 Cup(s) Calories 20 cal Vitamin E 0.006 mg Protein 1.4 g Thiamine 0.001 mg Carbohydrate 3.9 g Riboflavin 0.003 mg Total Fat 0.1 g Niacin 0.14 mg Saturated Fat 0.02 g Vitamin B6 0.002 mg Mono-Unsaturated 0.
Category:
Although cauliflower leaves are by-products of cauliflower cultivation, they may be used as a source of natural antioxidants, including phenols.
Category:
Searchable / sortable database of Brussels Sprouts varieties / cultivars tested in annual trials by the Vegetable program, Department of Plant Sciences.
Category:
Cauliflower is a type of cabbage that features a condensed head of thick, incompletely developed flowers and stalks, which typically have the appearance of white curd.
Category:
Visiting this web site requires a newer version of Netscape Communicator. Visit Microsoft's Web site to obtain the newest version of Internet Explorer, or visit Netscape's Web site to obtain the newest version of Netscape Communicator.
Category:
In the future, you may be able to munch carrot sticks in fun colors. In addition to orange, there will be purple, red, yellow, and white! Photograph courtesy Philipp W.
Category:
