+ Main Category
Biology: 18066
Agriculture: 7689
Horticulture: 3987
Forestry: 843
Geography: 5126
Environment: 5564
Research: 2212
Society: 448
+ Tell a Friend
Fill out the information below to email a friend a brief note about 'TropHort: Biology, Agriculture and Geography'
+ Top 10
+ Directory Statistics
Links: 41715
Categories: 7194
Registered Users: 637
Mailing List Subscribers: 127
+ Pagerank Statistics
+ Join Mailing List
Joining mailing list will entitle you
to receive occasional emails informing you of news and
updates to the site and any special offers that may be
of interest to you.
Grape Crop Germplasm Committee - NPGS, GRIN.
62486
Grape Crop Germplasm Committee - NPGS, GRIN.
http://www.ars-grin.gov/npgs/cgc_reports/grapecgc2001.htm
Enhanced governmental funding is needed to upgrade and strengthen the National Clonal Germplasm Repository (NCGR) system. The Davis and Geneva centers need to lead and direct efforts on grape germplasm characterization, acquisition, maintenance and distribution.
Horticulture > Fruits > Grape > Science
germplasm vitis vinifera grape cultivars breeding programs hybrids drought tolerance breeders genetic resources importation
Jan 1, 2007
Write a Review
Add to My Favorite
Refer it to Friend
Report Broken Link
Other links at Horticulture > Fruits > Grape > Science
[Federal Register: January 8, 1996 (Volume 61, Number 5)] [Rules and Regulations] [Page 522-541] From the Federal Register Online via GPO Access [wais.access.gpo.
Category:
>Q8S4W7|GAI1_VITVI DELLA protein GAI1 - Vitis vinifera (Grape). MKREYHHPHHPTCSTSPTGKGKMWDADPQQDAGMDELLAVLGYNVKASDMAEVAQKLEQL EEVIVNAQEDGLSHLASETVHYNPSDLSNWLGSMLSEFNPTPNCALDNPFLPPISPLDYT NCSTQPKQEPSIFDSPSLDYDLKAIPGKALYSHIEQPPQQPPAPPLYQRDNKRLKPTTSA
Category:
Crown gall is a common, devastating grape disease that has been known to result in losses of entire vineyards in Kentucky. Besides grapes, over 600 types of plants are known to be susceptible to crown gall, including apples, stone fruits and brambles.
Category:
Louisiana Ecosystems & Plant Identification: An Interactive Virtual Tour Dr. Michael Stine, Project Director: mstine@lsu.
Category:
1 The use of antioxidants and free radical scav- engers is widely accepted in both skin and hair care appli- cations. There are a multitude of natural sources for such materials.
Category:
PB 1475 Agricultural Extension Service The University of Tennessee Introduction 3 Types of Grapes 3 Site Selection 4 Soils 4 Propagation 4 Planting Time to plant 5 Purchasing vines 6 Spacing 6 Preplant care 7 Planting 7 Pruning and Training Terminology 8 Trellis design and construction 8 Training
Category:
Discover Life's encyclopedia page about the biology, natural history, ecology, identification and distribution of Dicotyledoneae: Vitaceae - Boston-ivy, Grapes, Virginia-creeper, Woodbine, Grape family, Grape, Creepers
Category:
On a recent sabbatical leave at the Charles Stuart University in Australia, Dr. Brown carried out preliminary investigative work using leaf and canopy measurements to differentiate areas of vineyard blocks with common characteristics, e.g., related to phylloxera infestation and nutrient status.
Category:
Grape seed extract contains chemicals known as polyphenols, (including the subclass of proanthocyanidins), which are recognized to be effective antioxidants.
Category:
As there is a strong relationship between ower development and starch, the starch content of reproductive structures was estimated. Key Results Inorescence and ower development were similar in the vines and cuttings with consistent differ- ences between the two cultivars.
Category:
