+ Main Category
Biology: 18066
Agriculture: 7684
Horticulture: 3982
Forestry: 843
Geography: 5126
Environment: 5562
Research: 2212
Society: 445
+ Tell a Friend
Fill out the information below to email a friend a brief note about 'TropHort: Biology, Agriculture and Geography'
+ Top 10
+ Directory Statistics
Links: 41700
Categories: 7193
Registered Users: 599
Mailing List Subscribers: 115
+ Pagerank Statistics
+ Join Mailing List
Joining mailing list will entitle you
to receive occasional emails informing you of news and
updates to the site and any special offers that may be
of interest to you.
SC177 1935 Grape Growing in Kansas.
62547
SC177 1935 Grape Growing in Kansas.
http://www.oznet.k-state.edu/historicpublications/Pubs/SC177.PDF
GRAPE GROWING IN KANSAS1 R. J. BARNETT INTRODUCTION The American grape is a comparatively new cultivated fruit. Old- world grapes were introduced at the beginning of the Colonial period and their culture attempted for two hundred years.
Horticulture > Fruits > Grape > Science
agricultural experiment station vineyard pruned shoots grape juice grower flea beetle grapevines injurious cover crop
Jan 1, 2004
Write a Review
Add to My Favorite
Refer it to Friend
Report Broken Link
Other links at Horticulture > Fruits > Grape > Science
Institute of Phytopathology and Applied Zoology, Justus Liebig University of Giessen, Germany Institute of Biology, Department of Phytomedicine, Geisenheim Research Institute, Germany Biological control of grape berry mothsEupoecilia ambiguella Hb. and Lobesia botrana Schiff.
Category:
Vitis aestivalis Michx. - Summer Grape | back | forward | Vitis aestivalis - (image 1 of 1) Taxonomy Family: Vitaceae Habitat Sandy soils, among scrubby black oaks. Shaded dune slopes. This specimen found atop a rocky bluff under chinkapin oak. Associates Distribution Morphology Notes Flowers
Category:
Lurie.doc. The Effect of Modified Atmosphere Packaging and an Ethanol Dip on Prevention of Botrytis rot of Table Grapes Lurie, S., Lichter, A., Zutahy, Y., Kaplonov, T. Department of Postharvest Science, Agricultural Research Organization, Volcani Center, Bet Dagan, Israel. slurie43@agri.gov.
Category:
Horvath, G.; Wessjohann, L.; Bigirimana, J.; Monica, H.; Jansen, M.; Guisez, Y.; Caubergs, R.; Horemans, N. 2006 Plant Physiology and Biochemistry 44(11/12): 724-731 Tocopherols and tocotrienols are present in mature seeds.
Category:
>Q8S4W7|GAI1_VITVI DELLA protein GAI1 - Vitis vinifera (Grape). MKREYHHPHHPTCSTSPTGKGKMWDADPQQDAGMDELLAVLGYNVKASDMAEVAQKLEQL EEVIVNAQEDGLSHLASETVHYNPSDLSNWLGSMLSEFNPTPNCALDNPFLPPISPLDYT NCSTQPKQEPSIFDSPSLDYDLKAIPGKALYSHIEQPPQQPPAPPLYQRDNKRLKPTTSA
Category:
This may not be Italy, but grapes can be successfully grown in Saskatchewan with proper care and a warm sunny summer. However, grapes are not a prominent fruit crop in the province, and most growers enjoy them for home consumption.
Category:
A deciduous vine to 30 ft. that, without support, makes a nice ground cover. Stems have shreddy bark and the white-fuzzy leaves are roundish and lobed. Fragrant, greenish-yellow flowers are followed by clusters of small, edible, black grapes.
Category:
Outstanding in breadth and coherence, this definitive review is designed to embrace the entire scope of wine culture, including vine horticulture, winery design, wine processing, wine quality control, wine analysis, and wine marketing.
Category:
Botrytis bunch rot is caused by the fungus Botrytis cinerea. Bunch rot can cause serious losses on highly susceptible grape varieties. Although
Category:
Silvia M. J. Pinent Carlos E. da C. Pinent Marcos Botton Luiza R. Redaelli Depto. Fitossanidade-UFRGS, Porto Alegre-RS Depto. Entomologia- Embrapa Uva e Vinho, Bento Gonçalves, RS Dep.
Category:
