+ Main Category
Biology: 18066
Agriculture: 7689
Horticulture: 3987
Forestry: 843
Geography: 5126
Environment: 5564
Research: 2417
Society: 448
+ Tell a Friend
Fill out the information below to email a friend a brief note about 'TropHort: Biology, Agriculture and Geography'
+ Top 10
+ Directory Statistics
Links: 41725
Categories: 7194
Registered Users: 667
Mailing List Subscribers: 135
+ Pagerank Statistics
+ Join Mailing List
Joining mailing list will entitle you
to receive occasional emails informing you of news and
updates to the site and any special offers that may be
of interest to you.
Fruit Maturity and Juice Extraction Influences Ellagic Acid Derivatives and Other Antioxidant Polyphenolics in Muscadine Grape.
62573
Fruit Maturity and Juice Extraction Influences Ellagic Acid Derivatives and Other Antioxidant Polyphenolics in Muscadine Grape.
http://sera-ieg-14.tamu.edu/reports/2005/Florida2005.pdf
SERA014 Progress Report 2005 GRAPE RESEARCH AND EXTENSION ACTIVITIES UNIVERSITY OF FLORIDA INSTITUTE OF FOOD AND AGRICULTURAL SCIENCES Mid-Florida Research & Education Center, University of Florida/IFAS Grapevine Genetics Research Program Submitted by: Dennis J. Gray djg@ifas.ufl.
Horticulture > Fruits > Grape > Science
ellagic acid muscadine grape transgenic juice cabernet sauvignon antioxidant resistant plants content fruit maturity vitis vinifera
Jan 1, 2006
Write a Review
Add to My Favorite
Refer it to Friend
Report Broken Link
Other links at Horticulture > Fruits > Grape > Science
Although many species and sub-species of grapes are indigenous to Texas (10), early commercial production efforts in Texas failed for several reasons. Yields were generally less than commercially acceptable because of poor vineyard management and poorly adapted cultivars (9).
Category:
2. Grape.
Euvitis - "True grapes"; elongated clusters, berries that adhere to stems at maturity, forked tendrils, loose bark that detaches in long strips, and diaphragms in pith at nodes.
Category:
University of Arkansas Division of Agriculture Cooperative Extension Service Horitculture landscape vines Grape Vitis sp.
Category:
The alkali-soluble xyloglucan (XGO-2) from exocarp and mesocarp was composed of Glc:Xyl:Gal:Fuc in a molar ratios of 4:1.7:1;8:0.4 and 4:1.5:2.5:0.5, respectively.
Category:
muscadine grape Vitaceae Vitis rotundifolia Leaf:Alternate, simple, cordate to orbicular, coarsely serrated, may be 3 lobed, 4 to 6 inches long, green above, hairless greenish yellow below. Flower:Small, greenish-white appearing in axillary panicles in late spring.
Category:
Louisiana Ecosystems & Plant Identification: An Interactive Virtual Tour Dr. Michael Stine, Project Director: mstine@lsu.
Category:
Also called bird's-eye rot, anthracnose on grapes reduces berry quality and may weaken the vine. The disease can be particularly severe in the southeastern United States due to the warm, humid weather.
Category:
Edited by R.C. Pearson and A.C. Goheen SCROLL DOWN TO ORDER THIS TITLE. Of interest to everyone who works with grapes. Includes sections on cultural practices and selection of planting material.
Category:
>Q8S4W7|GAI1_VITVI DELLA protein GAI1 - Vitis vinifera (Grape). MKREYHHPHHPTCSTSPTGKGKMWDADPQQDAGMDELLAVLGYNVKASDMAEVAQKLEQL EEVIVNAQEDGLSHLASETVHYNPSDLSNWLGSMLSEFNPTPNCALDNPFLPPISPLDYT NCSTQPKQEPSIFDSPSLDYDLKAIPGKALYSHIEQPPQQPPAPPLYQRDNKRLKPTTSA
Category:
GRAPE POWDERY MILDEW IS A THREAT EVEN IN A DRY YEAR By John Hartman, Plant Pathology Although drought and absence of rainy weather has slowed the development of many grape diseases in Kentucky this year, powdery mildew is not slowed by lack of rain.
Category:
