+ Main Category
Biology: 18066
Agriculture: 7689
Horticulture: 3987
Forestry: 843
Geography: 5126
Environment: 5564
Research: 2417
Society: 448
+ Tell a Friend
Fill out the information below to email a friend a brief note about 'TropHort: Biology, Agriculture and Geography'
+ Top 10
+ Directory Statistics
Links: 41727
Categories: 7194
Registered Users: 687
Mailing List Subscribers: 137
+ Pagerank Statistics
+ Join Mailing List
Joining mailing list will entitle you
to receive occasional emails informing you of news and
updates to the site and any special offers that may be
of interest to you.
Vitis sp., red grape - Plants, Flowering Plants at The Natural History Museum, London.
62701
Vitis sp., red grape - Plants, Flowering Plants at The Natural History Museum, London.
http://owen.nhm.ac.uk/piclib/www/comp.php?img=99996&cat=3&frm=med&search=cat_3
Vitis sp., red grape. A scanning electron microscope (SEM) image of a red grape (Vitis sp.), artificially coloured by computer.. Picture, Image, Photo, Photograph, The Natural History Museum, London
Horticulture > Fruits > Grape > Science
home visit enquiries flowering plants
Jan 1, 2007
Write a Review
Add to My Favorite
Refer it to Friend
Report Broken Link
Other links at Horticulture > Fruits > Grape > Science
PEST MANAGEMENT GRANTS DEPARTMENT OF PESTICIDE REGULATION MARCH 1999 Project Title: Establishment of Effective Natural Enemies of Vine Mealybug: A Basis for a Stable Grape IPM Program. Contract Number: 97-0242 Principal Investigator: D.
Category:
Take this citation to your librarian. Due to copyright restrictions, Waters cannot supply a copy of this reference.
Category:
The chemicals, formulations, and rates listed for insect, mite, and disease control are among the best recommendations based on label directions, research, and vineyard use experience.
Category:
1 Center of Investigation in Chemistry, Department of Chemistry, Faculty of Sciences and 2 Department of Anatomy, Porto Medical School, University of Porto, Porto, Portugal * Author to whom correspondence should be addressed at: Department of Anatomy, Porto Medical School, Al. Prof.
Category:
>Q8S4W7|GAI1_VITVI DELLA protein GAI1 - Vitis vinifera (Grape). MKREYHHPHHPTCSTSPTGKGKMWDADPQQDAGMDELLAVLGYNVKASDMAEVAQKLEQL EEVIVNAQEDGLSHLASETVHYNPSDLSNWLGSMLSEFNPTPNCALDNPFLPPISPLDYT NCSTQPKQEPSIFDSPSLDYDLKAIPGKALYSHIEQPPQQPPAPPLYQRDNKRLKPTTSA
Category:
This page contains color photographs and descriptive information about Vitis riparia.
Category:
A deciduous vine to 30 ft. that, without support, makes a nice ground cover. Stems have shreddy bark and the white-fuzzy leaves are roundish and lobed. Fragrant, greenish-yellow flowers are followed by clusters of small, edible, black grapes.
Category:
The red grape used commonly in wine making. The name may also refer to wines produced predominantly from pinot noir grapes. Pinot noir grapes are grown in diverse locations around the world, but the grape is chiefly associated with the Burgundy region of France.
Category:
I've added seeded grapes to the juice and the taste is now exceptional. Read about all the benefits of grape seed extract.
Category:
New York grown grapes delivered to wineries and processing plants (both in and out-of-state) in 2005 totaled 175,000 tons (see Table 2). This represents an increase of 25 percent from the 140,000 tons delivered from the 2004 crop.
Category:
