+ Main Category
Biology: 18066
Agriculture: 7684
Horticulture: 3982
Forestry: 843
Geography: 5126
Environment: 5562
Research: 2212
Society: 445
+ Tell a Friend
Fill out the information below to email a friend a brief note about 'TropHort: Biology, Agriculture and Geography'
+ Top 10
+ Directory Statistics
Links: 41702
Categories: 7193
Registered Users: 592
Mailing List Subscribers: 111
+ Pagerank Statistics
+ Join Mailing List
Joining mailing list will entitle you
to receive occasional emails informing you of news and
updates to the site and any special offers that may be
of interest to you.
Influence of grape (vitis vinfera/hybrid) polyphenols on dental biofilm related oral diseases.
62706
Influence of grape (vitis vinfera/hybrid) polyphenols on dental biofilm related oral diseases.
http://vivo.cornell.edu/entity?home=&id=28729
Search Advanced Search | Search Tips Home People Education & Training Research Tools Facilities Index About Contact Us Life Sciences in the Library New Life Sciences Initiative Cross-campus and Collaborative Initiatives Cornell University Library > VIVO INFLUENCE OF GRAPE (VITIS
Horticulture > Fruits > Grape > Science
food science biofilm agricultural experiment station polyphenols data warehouse
Jan 1, 2007
Write a Review
Add to My Favorite
Refer it to Friend
Report Broken Link
Other links at Horticulture > Fruits > Grape > Science
What is it? Grape Seed Extract is an herbal medicine used to treat vein problems, including varicose veins (large veins that are usually seen in the legs). It may also be used to prevent disease and to treat eye problems, like diabetic retinopathy (eye problems in diabetics).
Category:
Outstanding in breadth and coherence, this definitive review is designed to embrace the entire scope of wine culture, including vine horticulture, winery design, wine processing, wine quality control, wine analysis, and wine marketing.
Category:
3. Does Vitis Extract (White Grape Seed Tannin) Have an Effect on Escherichia coli Plasimd Competency?
CALIFORNIA STATE SCIENCE FAIR 2006 PROJECT SUMMARY Ap2/06 Name(s) Project Number Project Title Abstract Summary Statement Help Received Rena Banka Does Vitis Extract (White Grape Seed Tannin) Have an Effect on Escherichia coli Plasimd Competency?
Category:
1Department of Fruit Tree Breeding and Molecular Genetics, Agricultural Research Organization, The Volcani Center, P.O. Box 6 Bet-Dagan, 50250 Israel.
Category:
5. Resveratrol.
Grape Seed Extract-100 - For Dogs and Cats A nutritional supplement for the immune system, circulatory functions, and skin health. Grape seed extract supplement that is standardized to yield 9.5 mg (95%) proanthocyanidins (PCOs) per 10 mg capsule.
Category:
The red grape used commonly in wine making. The name may also refer to wines produced predominantly from pinot noir grapes. Pinot noir grapes are grown in diverse locations around the world, but the grape is chiefly associated with the Burgundy region of France.
Category:
Vitis vinifera, grape. A photograph of six of decorative ceiling panels from the roof of the Natural History Museum's Central Hall showing Vitis vinifera, grape.. Photograph taken for 'The Guilded Canopy' (2005) by Sandra Knapp and Bob Press published by the Natural History Museum, London..
Category:
Zoecklein, B.W., K.C.Fugelsang and B.H. Gump. 2005. In Press. Analytical Techniques in Wine and Distillates. Handbook of Enology, Haworth Press, Inc. N.Y.
Category:
Silvia M. J. Pinent Carlos E. da C. Pinent Marcos Botton Luiza R. Redaelli Depto. Fitossanidade-UFRGS, Porto Alegre-RS Depto. Entomologia- Embrapa Uva e Vinho, Bento Gonçalves, RS Dep.
Category:
>Q8S4W7|GAI1_VITVI DELLA protein GAI1 - Vitis vinifera (Grape). MKREYHHPHHPTCSTSPTGKGKMWDADPQQDAGMDELLAVLGYNVKASDMAEVAQKLEQL EEVIVNAQEDGLSHLASETVHYNPSDLSNWLGSMLSEFNPTPNCALDNPFLPPISPLDYT NCSTQPKQEPSIFDSPSLDYDLKAIPGKALYSHIEQPPQQPPAPPLYQRDNKRLKPTTSA
Category:
