+ Main Category
Biology: 18066
Agriculture: 7689
Horticulture: 3987
Forestry: 843
Geography: 5126
Environment: 5564
Research: 2417
Society: 448
+ Tell a Friend
Fill out the information below to email a friend a brief note about 'TropHort: Biology, Agriculture and Geography'
+ Top 10
+ Directory Statistics
Links: 41727
Categories: 7194
Registered Users: 687
Mailing List Subscribers: 137
+ Pagerank Statistics
+ Join Mailing List
Joining mailing list will entitle you
to receive occasional emails informing you of news and
updates to the site and any special offers that may be
of interest to you.
>Q8S4W7|GAI1_VITVI DELLA protein GAI1 - Vitis vinifera (Grape)....
62727
>Q8S4W7|GAI1_VITVI DELLA protein GAI1 - Vitis vinifera (Grape)....
http://www.expasy.org/uniprot/Q8S4W7.fas
>Q8S4W7|GAI1_VITVI DELLA protein GAI1 - Vitis vinifera (Grape). MKREYHHPHHPTCSTSPTGKGKMWDADPQQDAGMDELLAVLGYNVKASDMAEVAQKLEQL EEVIVNAQEDGLSHLASETVHYNPSDLSNWLGSMLSEFNPTPNCALDNPFLPPISPLDYT NCSTQPKQEPSIFDSPSLDYDLKAIPGKALYSHIEQPPQQPPAPPLYQRDNKRLKPTTSA
Horticulture > Fruits > Grape > Science
vitis vinifera
Jan 1, 2007
Write a Review
Add to My Favorite
Refer it to Friend
Report Broken Link
Other links at Horticulture > Fruits > Grape > Science
The use of microsatellite loci developed from a single plant species across a number of related taxa is becoming increasingly widespread. This approach can provide highly informative markers even for species for which microsatellites have not been characterized.
Category:
AGRICULTURE RECONSTRUCTION AND DEVELOPMENT PROGRAM FOR IRAQ GRAPE VARIETY BENCHMARKING PROJECT Final Report November 2005 This publication was produced for review by the United States Agency for International Development. It was prepared by Development Alternatives, Inc. Contract No.
Category:
Discover Life's encyclopedia page about the biology, natural history, ecology, identification and distribution of Dicotyledoneae: Vitaceae - Boston-ivy, Grapes, Virginia-creeper, Woodbine, Grape family, Grape, Creepers
Category:
1. A new and distinct variety of grapevine, botanically known as Vitis sp., identified as Arrathree, substantially as shown and described herein.
Category:
Mustang Grape is a high climbing vine that grows in the South Texas Plains and Edwards Plateau. It can grow up to 40 feet long. The crimson flowers grow in clusters which are between 2 and 3 inches long.
Category:
Mark Battany 2156 Sierra Way, Suite C 805-781-5948 Viticulture/Soils Farm Advisor San Luis Obispo, CA 93401 mcbattany@ucdavis.edu In 2006 I evaluated the soil salinity status of mature vineyards east of Paso Robles by testing soil samples from 100 locations.
Category:
Silvia M. J. Pinent Carlos E. da C. Pinent Marcos Botton Luiza R. Redaelli Depto. Fitossanidade-UFRGS, Porto Alegre-RS Depto. Entomologia- Embrapa Uva e Vinho, Bento Gonçalves, RS Dep.
Category:
Native American Technology & Art: An internet resource for indigenous ethno-technology focusing on the arts of Eastern Woodland Indian Peoples; providing historical & contemporary background, technical instruction & references.
Category:
Grape phylloxera is native to eastern United States, but has been distributed to other grape regions of the U.S. and is also established in Europe where it is of great economic importance.
Category:
Analytical Chemistry. Classified links of the Chemistry Biology Information Center of ETH Zürich.
Category:
