Home Biology Agriculture Horticulture Forestry Research Society
New Listings     Hot Listings     Top Rated     Editor Pick     Add a Listing      Upgrade a Listing     Update a Listing     Get Rated     Suggest a Category     Contact
+ Main Category

Biology: 18066
Geography: 5126
Research: 2417
Society: 448

+ Tell a Friend

Fill out the information below to email a friend a brief note about 'TropHort: Biology, Agriculture and Geography'

Your Name:
     
Your Email:
     
Friend's Name:
     
Friend's Email:
     

     


+ Top 10


+ Directory Statistics


Links: 41727
Categories: 7194
Registered Users: 687
Mailing List Subscribers: 137

+ Pagerank Statistics

PR 9
7 site(s)
PR 8
90 site(s)
PR 7
773 site(s)
PR 6
2544 site(s)
PR 5
4441 site(s)
PR 4
6484 site(s)
PR 3
6050 site(s)
PR 2
2628 site(s)
PR 1
847 site(s)

+ Join Mailing List

Joining mailing list will entitle you to receive occasional emails informing you of news and updates to the site and any special offers that may be of interest to you.



Science

Top > Horticulture > Fruits > Grape > Science

Provides scientific information and links to peer-reviewed papers, research articles, theses, books, abstracts, and other scholarly literature on grapes (Vitis, Vitidaceae).


Subscribe to this category


Popular Tags

Web Links
Sort By :
Hello all, I am looking for up to dat protocols for virus elimination from grape. Most papers I have seen are older than 1983.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

The red grape used commonly in wine making. The name may also refer to wines produced predominantly from pinot noir grapes. Pinot noir grapes are grown in diverse locations around the world, but the grape is chiefly associated with the Burgundy region of France.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

Latin Name:Vitis vinifera L. Patrt Used:Seeds Grape seed extract is a natural plant substance that has a concentrated source of oligomeric proanthocyanidins (OPC).It may help skin wounds heal faster and with less scarring . It (OPC) is the most used anti-oxidant in both health foods and cosmetics.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

Take this citation to your librarian. Due to copyright restrictions, Waters cannot supply a copy of this reference.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

Supply of Grape Seed Extract : Suppliers Trade Lead for Herbal Extract, Plant Extract, Grape Seed Extract, Shanghai Honghao Chemicals Co.,Ltd.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

Vitculture (Grape Growing) a presentation by David Sharp for Bus 416W Viticulture is the part of horticulture that deals solely with the growing of Vitis, the grapevine.
Details Hits: 1 Votes: 0 Ratings: Reviews: Google PR:

Vitis vinifera (wine grape) (EST) Genome info Pathway maps Gene catalogs Genome map Organism list -- Organism evvi Name V.vinifera_est, VITVI, 29760 Full name Vitis vinifera (wine grape) (EST) Definition Vitis vinifera (wine grape), EST contigs Taxonomy TAX: 29760 Lineage Eukaryota Viridiplantae
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

The state of Washington contains four appellations (viticultural regions distinguished by characteristics that result in wines with shared qualities): Puget Sound, Columbia Valley, Yakima Valley, and Walla Walla Valley.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

Search Advanced Search | Search Tips Home People Education & Training Research Tools Facilities Index About Contact Us Life Sciences in the Library New Life Sciences Initiative Cross-campus and Collaborative Initiatives Cornell University Library > VIVO INFLUENCE OF GRAPE (VITIS
Details Hits: 1 Votes: 0 Ratings: Reviews: Google PR:

Vitis riparia is the most common wild grape in Wisconsin. Leaves are alternate, simple and lobed (there can be dramatic differences in the lobing pattern from one leaf to the next). The lobes are generally sharp-pointed and there are also large sharp teeth along the margin.
Details Hits: 1 Votes: 0 Ratings: Reviews: Google PR:

Yield and quality of Vitis vinifera wine grape cultivars in Arkansas AFR 33(6):3 1984 R. K. Striegler and J. R. Morris THE PARAMETERS most often used to determine optimum harvest time for wine grapes in Arkansas are percent soluble solids and percent acidity.
Details Hits: 2 Votes: 0 Ratings: Reviews: Google PR:

Grape Skin - Vitis vinifera - has been cultivated for thousands of years and has long been to be beneficial to health.
Details Hits: 1 Votes: 0 Ratings: Reviews: Google PR:

This type grape, grown in the U.S. mainly in California and Arizona, constitutes the major portion (tonnage wise) produced bere. The plant is a long-lived woody vine.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

>Q8S4W7|GAI1_VITVI DELLA protein GAI1 - Vitis vinifera (Grape). MKREYHHPHHPTCSTSPTGKGKMWDADPQQDAGMDELLAVLGYNVKASDMAEVAQKLEQL EEVIVNAQEDGLSHLASETVHYNPSDLSNWLGSMLSEFNPTPNCALDNPFLPPISPLDYT NCSTQPKQEPSIFDSPSLDYDLKAIPGKALYSHIEQPPQQPPAPPLYQRDNKRLKPTTSA
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

Publikation (Beitrag in Tagungsband): CLAUS, A., KAMMERER, D.R., CARLE, R., SCHIEBER, A. (2006): Enzyme-assisted extraction of polyphenols from grape (Vitis vinifera L.) pomace
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

Also called bird's-eye rot, anthracnose on grapes reduces berry quality and may weaken the vine. The disease can be particularly severe in the southeastern United States due to the warm, humid weather.
Details Hits: 1 Votes: 0 Ratings: Reviews: Google PR:

please help, i am begginig pcr with vitis vinifera leaves and i need a positive control to chek if my RNA isolation is good. Does anyone knows of a suitable protein, abundant in plant leaves, that I can use to amplify by PCR as a control for my extraction?
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

GRAPE (Vitis vinifera White Riesling, Chardonnay, Pinot Noir, Cabernet Franc) J. W. Travis, N. O. Halbrendt, Botrytis bunch rot; Botrytis cinerea B. Lehman, B. Hed & B. Jarjour Ripe rot; Colletotrichum sp.
Details Hits: 2 Votes: 0 Ratings: Reviews: Google PR:

Pittsburg State University | Department of Biology | Sperry Herbarium | Illustrated Guides | Woody Plants Common name: Winter Grape Scientific name: Vitis cinera Family: Vitaceae Note: woody vine The Fruit last update: August 26, 2006 Contact Webmaster
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

Crown gall is a common, devastating grape disease that has been known to result in losses of entire vineyards in Kentucky. Besides grapes, over 600 types of plants are known to be susceptible to crown gall, including apples, stone fruits and brambles.
Details Hits: 5 Votes: 0 Ratings: Reviews: Google PR:

Pages: [< Previous] 1 2 3 4 5 6 7 8 9 10 [Next >] [Last >>]



Subscribe to this category


Valid XHTML 1.0 Transitional   Valid CSS