Home Biology Agriculture Horticulture Forestry Research Society
New Listings     Hot Listings     Top Rated     Editor Pick     Add a Listing      Upgrade a Listing     Update a Listing     Get Rated     Suggest a Category     Contact
+ Main Category

Biology: 18066
Geography: 5126
Research: 2212
Society: 445

+ Tell a Friend

Fill out the information below to email a friend a brief note about 'TropHort: Biology, Agriculture and Geography'

Your Name:
     
Your Email:
     
Friend's Name:
     
Friend's Email:
     

     


+ Top 10


+ Directory Statistics


Links: 41700
Categories: 7193
Registered Users: 599
Mailing List Subscribers: 115

+ Pagerank Statistics

PR 9
7 site(s)
PR 8
99 site(s)
PR 7
712 site(s)
PR 6
2234 site(s)
PR 5
3936 site(s)
PR 4
5782 site(s)
PR 3
4856 site(s)
PR 2
2017 site(s)
PR 1
616 site(s)

+ Join Mailing List

Joining mailing list will entitle you to receive occasional emails informing you of news and updates to the site and any special offers that may be of interest to you.




Web Links [Tag : carota]


Sort By :
Dr. K.-H. Neumann Gießen 2001 Dekan: Prof. Dr. P. M. Schmitz Vorsitzender: Prof. Dr. J. Bottler 1. Gutachter: Prof. Dr. K.-H. Neumann 2. Gutachter: Prof. Dr. W. Friedt Prüfer: Prof. Dr. I. Bitsch Prüfer: Prof. Dr. B.
Details Hits: 1 Votes: 0 Ratings: Reviews: Google PR:

Rubus spp. Rudbeckia hirta Rumex acetosa Rumex acetosella Rumex altissimus Rumex crispus Rumex maritimus var. persicarioides Rumex obtusifolius Rumex stenophyllus Salsola australis Salsola paulsenii Salsola pestifer Salvia officinallis Sarcobatus vermiculatus Schizachyrium scoparium Scirpus spp.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

Africa, Asia, Europe, Middle East, North America, and South America.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

The carrot is a variable annual or biennial plant from 1 to 3 feet tall with branching stems, fern-like leaves, and tiny white flowers that may turn purple in the center.
Details Hits: 5 Votes: 0 Ratings: Reviews: Google PR:

biennial that is closely related to garden carrots, but with a much reduced taproot. During the second year of growth, the plants produce stalks with white, flat-topped flowers.
Details Hits: 2 Votes: 0 Ratings: Reviews: Google PR:

Weed management in domestic carrot production is characterized by high yield loss potential, few herbicides, and heavy reliance on handweeding. The most troublesome weed in carrot is volunteer potato and no herbicides are registered for control of the wee...
Details Hits: 1 Votes: 0 Ratings: Reviews: Google PR:

B. Michalik D. Grzebelus R. Baranski T. Kotlinska Introduction Carrot is one of the most important vegetables grown in Poland, used as a fresh vegetable all year long as well as for juice production, canning and baby food.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

Ibrahim MA, Oksanen EJ, Holopainen JK. Effects of limonene on the growth and physiology of cabbage (Brassica oleracea L) and carrot (Daucus carota L) plants. J Sci Food Agric 2004:84:1319-1326.
Details Hits: 1 Votes: 0 Ratings: Reviews: Google PR:

Engineering technical paper: Evaluation of Carrots (Daucus carota L.) Grown in Two Hydroponic Systems for Inclusion in NASA's Advanced Food Systems
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

Carrot - Daucus carota - has been used to encourage delayed menstruation, and can induce uterine contractions in pregnant women.
Details Hits: 1 Votes: 0 Ratings: Reviews: Google PR:

Take this citation to your librarian. Due to copyright restrictions, Waters cannot supply a copy of this reference.
Details Hits: 1 Votes: 0 Ratings: Reviews: Google PR:

Calcium channels have been suggested to play a major role in the initiation of a large number of signal transduction processes in higher plant cells. However, molecular components of higher plant Ca2+ channels remain unidentified to date.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

Publication: KAMMERER, D., CARLE, R., SCHIEBER, A. (2004): Quantification of anthocyanins in black carrot extracts (Daucus carota ssp. sativus var. atrorubens Alef.) and evaluation of their color properties
Details Hits: 3 Votes: 0 Ratings: Reviews: Google PR:

>P83218|PME_DAUCA Pectinesterase - Daucus carota (Carrot). QSSTVTPNVVVAADGSGDYKTVSEAVAAAPEDSKTRYVIRIKAGVYRENVDVPKKKKNIM FLGDGRTSTIITASKNVQDGSTTFNSATVAAVGAGFLARDITFQNTAGAAKHQAVALRVG SDLSAFYRCDILAYQDSLYVHSNRQFFINCFIAGTVDFIFGNAAVVLQDCDIHARRPGSG
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

Symptoms: The disease usually starts on the leaf margins of older leaves, causing dark-brown to black spots with yellow borders. The expansion of numerous spots on a leaf will cause chlorosis (yellowing) and eventually necrosis (death) of the entire leaflet.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

Generated from scop database 1.71 with scopm 1.101 on Fri Oct 20 11:07:05 2006 Copyright © 1994-2005 The scop authors / scop@mrc-lmb.cam.ac.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

The American Phytopathological Society is an international scientific organization that promotes the study and management of plant diseases through publications, meetings, and APSnet.
Details Hits: 1 Votes: 0 Ratings: Reviews: Google PR:

Leaves extremely deeply lobed*, fringe-like in appearance. Sprout from lower portions of the plant around and from several, central, hairy stems from which flowers blossom.
Details Hits: 2 Votes: 0 Ratings: Reviews: Google PR:

Molecular and Cellular Biochemistry 123:159-166,1993. 9 1993Kluwer Academic Publishers. Printed in the Netherlands. Characterization of the non-specific lipid transfer protein EP2 from carrot (Daucus carota L.) Ellen A. Meijer, 1Sacco C. de Vries, 1Peter Sterk, ~ Dorus W.J. Gadella Jr.,2 Karel W.A.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

Plant and Soil 253: 381390, 2003. © 2003 Kluwer Academic Publishers. Printed in the Netherlands. 381 Bacterial endophytes in processing carrots (Daucus carota L. var. sativus): their localization, population density, biodiversity and their effects on plant growth Monique A. Surette1, Antony V.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

Pages: 1 2 3 4 5 6 7 [Next >]



Valid XHTML 1.0 Transitional   Valid CSS