+ Main Category
Biology: 18066
Agriculture: 7689
Horticulture: 3987
Forestry: 843
Geography: 5126
Environment: 5564
Research: 2212
Society: 448
+ Tell a Friend
Fill out the information below to email a friend a brief note about 'TropHort: Biology, Agriculture and Geography'
+ Top 10
+ Directory Statistics
Links: 41715
Categories: 7194
Registered Users: 637
Mailing List Subscribers: 127
+ Pagerank Statistics
+ Join Mailing List
Joining mailing list will entitle you
to receive occasional emails informing you of news and
updates to the site and any special offers that may be
of interest to you.
Web Links [Tag : mosaic]
We have established a regeneration protocol for melon (Cucumis melo L.), using cotyledons as explants, in which the overall regeneration frequency reached more than 90 percent, and combined this protocol with Agrobacterium tumefaciens transformation to produce transgenic melon plants.
Details Hits: 1 Votes: 0 Ratings: 
Reviews: 
Google PR: HOME HORTICULTURE http://www.msue.msu.edu/msue/imp/mod03/master03.html This information is for educational purposes only. References to commercial products or trade names does not imply endorsement by MSU Extension or bias against those not mentioned.
Details Hits: 2 Votes: 0 Ratings: Reviews: Google PR: 1 Centro de Investigación en Biología Celular y Molecular (CIBCM), Universidad de Costa Rica, San José, Costa Rica, fax (506) 207 3190, emailcrivera@sol.racsa.co.cr
Details Hits: 1 Votes: 0 Ratings: Reviews: Google PR: Momordica chanrantia is a member of the Cucurbitaceae (gourd) family, and is therefore a relative of squash, watermelon, muskmelon and cucumber. In the United States varieties will just be listed as bitter melon, balsam pear, or fu kwa.
Details Hits: 2 Votes: 0 Ratings: Reviews: Google PR: Diseases By Crop (Fact Sheets) Search Function Photo Gallery News Articles/ Disease Alerts Diagnostic Keys Virus Weed Hosts/ Rotation Lists Resistant Varieties Glossary of Plant Pathology Terms Vegetable Guidelines Vegetable IPM Links Other Vegetable Links Cornell Plant Disease
Details Hits: 1 Votes: 0 Ratings: Reviews: Google PR: 6. 56.0.1.
Virions not enveloped (38/38). Nucleocapsids filamentous (51/51); usually flexuous (45/45); with a clear modal length (50/50); 445-523.1-775 nm long; 11-12.8-15 nm in diameter. Symmetry helical. Axial canal obvious (2/35), or obscure (33/35). Axial canal 3.4-6.3-12 nm in diameter.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: We have previously shown that cauliflower mosaic virus (CaMV) is able to recombine with Nicotiana bigelovii plants that contain a CaMV transgene under conditions of strong selection pressure. We constructed transgenic N.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: 1 Plant Virology Department, Plant Pests and Diseases Research Institute, P.O. Box 19395-1454, Tehran, Iran 2 Plant Protection Department, College of Agriculture and Natural Resources, Science and Research Campus, Islamic Azad University, P.O.
Details Hits: 2 Votes: 0 Ratings: Reviews: Google PR: (The text below is a condensate of a scientific article, "The use of cauliflower mosaic virus" by professor Joe Cummins. The scientific references have been left out here.)
Details Hits: 1 Votes: 0 Ratings: Reviews: Google PR: Transmitted by a vector; an insect; Brevicoryne brassicae, Myzus persicae and at least 25 other species; Aphididae. Transmitted in a semi-persistent manner.
Details Hits: 1 Votes: 0 Ratings: Reviews: Google PR: Dear Dr. lederman, Thanks very much for the information. The replication strategies and intermediate forms in Hepatitis B and cauliflower mosaic virus might be very close.
Details Hits: 1 Votes: 0 Ratings: Reviews: Google PR: Details Hits: 0 Votes: 0 Ratings:
Reviews: Google PR: Your browser does not support frames. Click here to view the unframed reprint.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: A single rep protein initiates replication of multiple genome components of faba bean necrotic yellows virus, a single-stranded DNA virus of plants.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: Vectors based upon the genome of cauliflower mosaic virus (CaMV) have only a limited capacity for replicating foreign DNA in plants. A helper virus system has been developed to complement CaMV constructs capable of carrying a large foreign gene (glucuronidase; GUS).
Details Hits: 2 Votes: 0 Ratings: Reviews: Google PR: By knocking out a gene, researchers are better able to study the function of the inactivated gene. One way to accomplish this inactivation is by using a knockout vector. Knockout plants can aid scientists in a variety of areas, including disease resistance.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: >gnl|CDD|2677 pfam02160, Peptidase_A3, Cauliflower mosaic virus peptidase (A3) NPNSIYIKGKLYFKGYKAYSLHCYVDTGASLCIASKKIIPEEYWENAKKPIEVKIANGSIITITKVCSNLFLKIAGKRFL IPTVYQQESGIDLILGNNFCKLYNPFIQYLDRIEFHKKNLEPVEIKKITKAILVGNEGFLESMKKISKTQQPYPFNITIN TIQLEEICSINPGDEEKLFNTIIIKIQLIEPLLEKVCSENP
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: promoter, which is known to be one of the most potent promoters in mammalian cells. The 35S promoter must therefore be considered to be a promoter of significant potency in mammalian cells.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: Department of Plant Pathology, University of California Davis, CA 95616, USA 2Department of Bacteriology, University of California Davis, CA 95616, USA 1To whom reprint requests should be addressed. Received April 21, 1981.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: *Address all correspondence to: Dr. Stephen H.Howell, c/o Laboratory of Dr. W.J.Peacock, CSIRO, Division of Plant Industry, P Box 1600, Canberra City, ACT 2601, Australia Received July 27, 1983. Revised December 15, 1983. Accepted December 15, 1983.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:
