Home Biology Agriculture Horticulture Forestry Research Society
New Listings     Hot Listings     Top Rated     Editor Pick     Add a Listing      Upgrade a Listing     Update a Listing     Get Rated     Suggest a Category     Contact
+ Main Category

Biology: 18066
Geography: 5126
Research: 2417
Society: 448

+ Tell a Friend

Fill out the information below to email a friend a brief note about 'TropHort: Biology, Agriculture and Geography'

Your Name:
     
Your Email:
     
Friend's Name:
     
Friend's Email:
     

     


+ Top 10


+ Directory Statistics


Links: 41725
Categories: 7194
Registered Users: 671
Mailing List Subscribers: 136

+ Pagerank Statistics

PR 9
7 site(s)
PR 8
87 site(s)
PR 7
762 site(s)
PR 6
2539 site(s)
PR 5
4403 site(s)
PR 4
6417 site(s)
PR 3
5951 site(s)
PR 2
2573 site(s)
PR 1
818 site(s)

+ Join Mailing List

Joining mailing list will entitle you to receive occasional emails informing you of news and updates to the site and any special offers that may be of interest to you.




Web Links [Tag : peptidase]


Sort By :
>gnl|CDD|2677 pfam02160, Peptidase_A3, Cauliflower mosaic virus peptidase (A3) NPNSIYIKGKLYFKGYKAYSLHCYVDTGASLCIASKKIIPEEYWENAKKPIEVKIANGSIITITKVCSNLFLKIAGKRFL IPTVYQQESGIDLILGNNFCKLYNPFIQYLDRIEFHKKNLEPVEIKKITKAILVGNEGFLESMKKISKTQQPYPFNITIN TIQLEEICSINPGDEEKLFNTIIIKIQLIEPLLEKVCSENP
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, S-, T- or U-, according to the catalytic type.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:

Mihr, C., Baumgärtner, M., Dieterich, J.H., Schmitz, U.K. and Braun, HP (2000) Proteomic approach for investigation of cytoplasmic male sterility (CMS) in Brassica. submitted. Wehrhahn, W., Niemeyer, A., Jänsch, L., Kruft, V., Schmitz, U.K. and Braun, H.P.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:



Valid XHTML 1.0 Transitional   Valid CSS