+ Main Category
Biology: 18066
Agriculture: 7689
Horticulture: 3987
Forestry: 843
Geography: 5126
Environment: 5564
Research: 2417
Society: 448
+ Tell a Friend
Fill out the information below to email a friend a brief note about 'TropHort: Biology, Agriculture and Geography'
+ Top 10
+ Directory Statistics
Links: 41727
Categories: 7194
Registered Users: 691
Mailing List Subscribers: 137
+ Pagerank Statistics
+ Join Mailing List
Joining mailing list will entitle you
to receive occasional emails informing you of news and
updates to the site and any special offers that may be
of interest to you.
Web Links [Tag : vinifera]
Agrobacterium tumefaciens that infects more than 2,000 species of plants. Crown gall of grape is a major problem in cold climate regions. Wounds are necessary for infection to occur. Observations suggest that freeze injury wounds are highly conducive to infection.
Details Hits: 2 Votes: 0 Ratings: 
Reviews: 
Google PR: In the area of south-eastern and -western Styria grape vine is a widely spread crop. In these areas the cultivation of grape vine and the production of vine is an important economical factor. Nowadays the by-product grape pomace mostly is composted and used as a fertilizer in the grape yards.
Details Hits: 4 Votes: 0 Ratings: Reviews: Google PR: Texas or Cotton root rot of grape is caused by the soil borne fungus Phymatotrichopsis omnivora (Phymatotrichum omnivorum). At low elevations, the first symptom of infection is wilting of the leaves or a fast decline.
Details Hits: 1 Votes: 0 Ratings: Reviews: Google PR: The red grape used commonly in wine making. The name may also refer to wines produced predominantly from pinot noir grapes. Pinot noir grapes are grown in diverse locations around the world, but the grape is chiefly associated with the Burgundy region of France.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: Latin Name:Vitis vinifera L. Patrt Used:Seeds Grape seed extract is a natural plant substance that has a concentrated source of oligomeric proanthocyanidins (OPC).It may help skin wounds heal faster and with less scarring . It (OPC) is the most used anti-oxidant in both health foods and cosmetics.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: Take this citation to your librarian. Due to copyright restrictions, Waters cannot supply a copy of this reference.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: Supply of Grape Seed Extract : Suppliers Trade Lead for Herbal Extract, Plant Extract, Grape Seed Extract, Shanghai Honghao Chemicals Co.,Ltd.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: Vitculture (Grape Growing) a presentation by David Sharp for Bus 416W Viticulture is the part of horticulture that deals solely with the growing of Vitis, the grapevine.
Details Hits: 1 Votes: 0 Ratings: Reviews: Google PR: Vitis vinifera (wine grape) (EST) Genome info Pathway maps Gene catalogs Genome map Organism list -- Organism evvi Name V.vinifera_est, VITVI, 29760 Full name Vitis vinifera (wine grape) (EST) Definition Vitis vinifera (wine grape), EST contigs Taxonomy TAX: 29760 Lineage Eukaryota Viridiplantae
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: The state of Washington contains four appellations (viticultural regions distinguished by characteristics that result in wines with shared qualities): Puget Sound, Columbia Valley, Yakima Valley, and Walla Walla Valley.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: Yield and quality of Vitis vinifera wine grape cultivars in Arkansas AFR 33(6):3 1984 R. K. Striegler and J. R. Morris THE PARAMETERS most often used to determine optimum harvest time for wine grapes in Arkansas are percent soluble solids and percent acidity.
Details Hits: 2 Votes: 0 Ratings: Reviews: Google PR: Grape Skin - Vitis vinifera - has been cultivated for thousands of years and has long been to be beneficial to health.
Details Hits: 1 Votes: 0 Ratings: Reviews: Google PR: This type grape, grown in the U.S. mainly in California and Arizona, constitutes the major portion (tonnage wise) produced bere. The plant is a long-lived woody vine.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: >Q8S4W7|GAI1_VITVI DELLA protein GAI1 - Vitis vinifera (Grape). MKREYHHPHHPTCSTSPTGKGKMWDADPQQDAGMDELLAVLGYNVKASDMAEVAQKLEQL EEVIVNAQEDGLSHLASETVHYNPSDLSNWLGSMLSEFNPTPNCALDNPFLPPISPLDYT NCSTQPKQEPSIFDSPSLDYDLKAIPGKALYSHIEQPPQQPPAPPLYQRDNKRLKPTTSA
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: Publikation (Beitrag in Tagungsband): CLAUS, A., KAMMERER, D.R., CARLE, R., SCHIEBER, A. (2006): Enzyme-assisted extraction of polyphenols from grape (Vitis vinifera L.) pomace
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: please help, i am begginig pcr with vitis vinifera leaves and i need a positive control to chek if my RNA isolation is good. Does anyone knows of a suitable protein, abundant in plant leaves, that I can use to amplify by PCR as a control for my extraction?
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: GRAPE (Vitis vinifera White Riesling, Chardonnay, Pinot Noir, Cabernet Franc) J. W. Travis, N. O. Halbrendt, Botrytis bunch rot; Botrytis cinerea B. Lehman, B. Hed & B. Jarjour Ripe rot; Colletotrichum sp.
Details Hits: 2 Votes: 0 Ratings: Reviews: Google PR: Crown gall is a common, devastating grape disease that has been known to result in losses of entire vineyards in Kentucky. Besides grapes, over 600 types of plants are known to be susceptible to crown gall, including apples, stone fruits and brambles.
Details Hits: 5 Votes: 0 Ratings: Reviews: Google PR: Grape Seed Extract This fact sheet provides basic information about grape seed extractuses, potential side effects, and resources for more information. The grape seeds used to produce this extract are generally obtained from wine manufacturers.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: 1 Instituto de Investigaciones Agropecuarias, Centro Regional de Investigación La Platina, Casilla 33/3, Santiago, Chile. E-mail: nhewston@inia.cl * Autor para correspondencia. Recibido: 18 de mayo de 2006.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR:
