+ Main Category
Biology: 18066
Agriculture: 7689
Horticulture: 3987
Forestry: 843
Geography: 5126
Environment: 5564
Research: 2417
Society: 448
+ Tell a Friend
Fill out the information below to email a friend a brief note about 'TropHort: Biology, Agriculture and Geography'
+ Top 10
+ Directory Statistics
Links: 41728
Categories: 7194
Registered Users: 684
Mailing List Subscribers: 137
+ Pagerank Statistics
+ Join Mailing List
Joining mailing list will entitle you
to receive occasional emails informing you of news and
updates to the site and any special offers that may be
of interest to you.
Web Links [Tag : virus]
(The text below is a condensate of a scientific article, "The use of cauliflower mosaic virus" by professor Joe Cummins. The scientific references have been left out here.)
Details Hits: 1 Votes: 0 Ratings: 
Reviews: 
Google PR: Transmitted by a vector; an insect; Brevicoryne brassicae, Myzus persicae and at least 25 other species; Aphididae. Transmitted in a semi-persistent manner.
Details Hits: 1 Votes: 0 Ratings: Reviews: Google PR: Dear Dr. lederman, Thanks very much for the information. The replication strategies and intermediate forms in Hepatitis B and cauliflower mosaic virus might be very close.
Details Hits: 1 Votes: 0 Ratings: Reviews: Google PR: Details Hits: 0 Votes: 0 Ratings:
Reviews: Google PR: Your browser does not support frames. Click here to view the unframed reprint.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: J. theor. Biol. (2002) 217, 195201 doi:10.1006/yjtbi.3023, available online at http://www.idealibrary.com on Third Position Codon Composition Suggests Two Classes of Genes Within the Cauliower Mosaic Virus Genome S. M. Leisner*w and D. A.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: A single rep protein initiates replication of multiple genome components of faba bean necrotic yellows virus, a single-stranded DNA virus of plants.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: Vectors based upon the genome of cauliflower mosaic virus (CaMV) have only a limited capacity for replicating foreign DNA in plants. A helper virus system has been developed to complement CaMV constructs capable of carrying a large foreign gene (glucuronidase; GUS).
Details Hits: 2 Votes: 0 Ratings: Reviews: Google PR: By knocking out a gene, researchers are better able to study the function of the inactivated gene. One way to accomplish this inactivation is by using a knockout vector. Knockout plants can aid scientists in a variety of areas, including disease resistance.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: >gnl|CDD|2677 pfam02160, Peptidase_A3, Cauliflower mosaic virus peptidase (A3) NPNSIYIKGKLYFKGYKAYSLHCYVDTGASLCIASKKIIPEEYWENAKKPIEVKIANGSIITITKVCSNLFLKIAGKRFL IPTVYQQESGIDLILGNNFCKLYNPFIQYLDRIEFHKKNLEPVEIKKITKAILVGNEGFLESMKKISKTQQPYPFNITIN TIQLEEICSINPGDEEKLFNTIIIKIQLIEPLLEKVCSENP
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: promoter, which is known to be one of the most potent promoters in mammalian cells. The 35S promoter must therefore be considered to be a promoter of significant potency in mammalian cells.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: Department of Plant Pathology, University of California Davis, CA 95616, USA 2Department of Bacteriology, University of California Davis, CA 95616, USA 1To whom reprint requests should be addressed. Received April 21, 1981.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: *Address all correspondence to: Dr. Stephen H.Howell, c/o Laboratory of Dr. W.J.Peacock, CSIRO, Division of Plant Industry, P Box 1600, Canberra City, ACT 2601, Australia Received July 27, 1983. Revised December 15, 1983. Accepted December 15, 1983.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, S-, T- or U-, according to the catalytic type.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: The human Hepatitis B virus (HBV) is the type member of the hepadnaviruses, animal infecting pararetroviruses (Nassal and Schaller, 1993; Seeger and Mason, 2000).
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: Nutmegs - contamination with aflatoxins. Study for the evaluation of raw material. 17 - Performance of sampling plans to determine aflatoxin in farmers' stock peanut lots by measuring aflatoxin in high-risk-grade components.
Details Hits: 1 Votes: 0 Ratings: Reviews: Google PR: The majority of crop plant constructions for herbicide or disease resistance employ a Promoter from cauliflower mosaic virus (CaMV). Regardless of the gene transferred, all transfers require a promoter, which is like a motor driving production of the genes' message.
Details Hits: 1 Votes: 0 Ratings: Reviews: Google PR: The genetic engineering community has assumed that Agrobacterium, a commonly used gene transfer vector for plants, does not infect animal cells, and certainly would not transfer genes into them. But this has been proved wrong. Prof. Joe Cummins warns of hazards to laboratory and farm workers.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: Your browser does not support frames. Click here to view the unframed reprint.
Details Hits: 0 Votes: 0 Ratings: Reviews: Google PR: The CaMV promoter gene has been found to be a "hot spot" for recombination leading to exchange of gene sequences at elevated frequency (Ho et al Microbial Ecology in Health and Disease (no.4,1999)..
Details Hits: 1 Votes: 0 Ratings: Reviews: Google PR:
